PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco025401.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family ARF
Protein Properties Length: 993aa    MW: 110774 Da    PI: 5.097
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco025401.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B369.83.6e-22145246199
                  EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                  f+k lt sd++++g +++p++ ae+       + ++  +++lt++d++ + W++++iyr++++r++lt+GW+ Fv  ++Lk+gD v+F   ++++ +l
  Aco025401.1 145 FCKNLTASDTSTHGGFSVPRRAAEKLfpqldySVQP-PNQELTVRDLHDNLWTFRHIYRGQPKRHLLTTGWSLFVGTKRLKAGDAVLFI--RDEKSQL 239
                  89*********************999****974344.4459************************************************..4567778 PP

                  EEEEE-S CS
           B3  93 vvkvfrk 99 
                  +++v+r+
  Aco025401.1 240 LLGVRRA 246
                  9999997 PP

2Auxin_resp120.51.3e-39271353183
   Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                  aahaa+++s+F+v+YnPra++s+F+++++k++ka +++vsvGmRf m+fete+s +rr++Gt+vg++d+dp+rWpnSkWr+L+
  Aco025401.1 271 AAHAAANRSPFTVYYNPRACPSDFIIPLAKYNKAAYTQVSVGMRFGMMFETEESTKRRYMGTIVGINDYDPLRWPNSKWRNLQ 353
                  79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.35E-45133274IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.5E-39139259IPR015300DNA-binding pseudobarrel domain
CDDcd100171.41E-19144245No hitNo description
PROSITE profilePS5086312.294145247IPR003340B3 DNA binding domain
PfamPF023628.4E-20145246IPR003340B3 DNA binding domain
SMARTSM010195.4E-22145247IPR003340B3 DNA binding domain
PfamPF065071.7E-35271353IPR010525Auxin response factor
PfamPF023096.0E-9886976IPR033389AUX/IAA domain
PROSITE profilePS5174524.164888972IPR000270PB1 domain
SuperFamilySSF542772.94E-7907967No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0009908Biological Processflower development
GO:0009942Biological Processlongitudinal axis specification
GO:0010305Biological Processleaf vascular tissue pattern formation
GO:0048364Biological Processroot development
GO:0048507Biological Processmeristem development
GO:0005634Cellular Componentnucleus
GO:0016020Cellular Componentmembrane
GO:0042802Molecular Functionidentical protein binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 993 aa     Download sequence    Send to blast
MCSTLEQGKS ACLSSAAPVL DEMKLLAEAQ CKTGAKNVIH SELWHACAGP LVSLPPPGSL  60
VYYFPQGHSE QVTATTRRTA NSHIPNYPNL PSQLMCQVHN VTLHADKDTD EIYAQMTLQP  120
VNSESDILPI PDLGLTRSKH PTDFFCKNLT ASDTSTHGGF SVPRRAAEKL FPQLDYSVQP  180
PNQELTVRDL HDNLWTFRHI YRGQPKRHLL TTGWSLFVGT KRLKAGDAVL FIRDEKSQLL  240
LGVRRANRQQ SALPSSVLST DSMHIGVLAA AAHAAANRSP FTVYYNPRAC PSDFIIPLAK  300
YNKAAYTQVS VGMRFGMMFE TEESTKRRYM GTIVGINDYD PLRWPNSKWR NLQVEWDEYG  360
CGERPERVSL FEIEMPESLF VFPSPSVNPK RQCLPGCSMP GTESIGFQNM TSRSVENMYG  420
SVDHLVSGLA MKFLNHFQNS NVSGQLECLQ PLYGSTVHDI KCNFISRSYP AILPTSSAIQ  480
YPLKQKDVLG NLEMQKELHL PLQNAHLENR SSQSCRLPRG ADLVCASGVH VASQEQCEEE  540
SNSGLNCVDR NEKNEASVPA ENQDEEYHSM KRQLSDQSLT DHLECRNGEN SSDPLNHENF  600
FSKIIDSQGL QHDKCSDLQQ IKQHLDPVVM STNQESSCSP DNSDPVSKPP LQGCMSHFLD  660
NADWMFQPSY YQDFSGIQHS LTTDDRPDAL FLSASENITN SSADISSIVN PRAFDPHETF  720
QSPYLSDLHT LQCLPNSVQE FLGSPELNPL SFISSEDQNV AVQASNKCGR KGLSEKSNDQ  780
SETFSNLHFE DGDRGFLVGP SAQATTTLED FDLGEYSKFN VPFQSLACDF VSQEMQSQIT  840
STSFAESQVI SLHENFDHSG GISSCSIDAS DYDWSRDTKK QVSQPPLRTF TKVQKLGSVG  900
RSIDVTRFRD YRELKSAIAF MFGLEGKLDD SSCSEWKLVY VDYENDVLLV GDDPWEEFIN  960
CVRCIRILSP SEVQQMSQDG LQLMNGFVQL GQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A0.01537829392Auxin response factor 5
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00153DAPTransfer from AT1G19850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010934525.10.0PREDICTED: auxin response factor 11 isoform X1
SwissprotQ01K260.0ARFK_ORYSI; Auxin response factor 11
SwissprotQ8S9830.0ARFK_ORYSJ; Auxin response factor 11
TrEMBLI1J3100.0I1J310_BRADI; Auxin response factor
STRINGBRADI5G25157.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86733241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19850.10.0ARF family protein